PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G166900.1
Common NamePOPTR_0009s16830g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 904aa    MW: 100711 Da    PI: 7.731
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G166900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.6e-28587637252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l++yF++++kdAAk++gvc+T+LKriCR++GI RWP+Rkik++
  Potri.009G166900.1 587 EKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRKHGITRWPSRKIKKV 637
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.382576657IPR003035RWP-RK domain
PfamPF020421.8E-24589637IPR003035RWP-RK domain
SuperFamilySSF542775.89E-23786880No hitNo description
Gene3DG3DSA:3.10.20.2403.0E-23793873No hitNo description
SMARTSM006661.8E-24794877IPR000270PB1 domain
PROSITE profilePS5174522.936794877IPR000270PB1 domain
PfamPF005648.3E-17795876IPR000270PB1 domain
CDDcd064072.18E-43795876No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 904 aa     Download sequence    Send to blast
MDDGNGAFAP DSSFGNFSDA AMDLDFVDEL LYDGCCFETV DEFGFLEAGT SASNDLNDPK  60
QYLPFFESNS CNLNVNPCQE NYQVATEKNF QSGGFLVEKN ELGRRLWIAP TNNARSSTGV  120
RERLMHAIGQ LKQCTKDRDL LIQIWVPIKK EGKHVLTTFG QPYLLNPKSQ SLASYRNVSK  180
KFQFPAEEDS KELVGLPGRV FLRKLPEWTP DVSYFSWVEY PRKNHAKQFN IRGSFAVPVF  240
EQGSRTCLGV IEVVTTTQDV SYRSELESVC KALEAVDLRS PKDFRPSSLK ACKEFCQAAV  300
PEISKILESV CKTHRLPLAL TWAPCFRQGK GGCRHFDENY SNCICTVNSA CFVAETDNFG  360
FYVACSEQYL SFGQGIVGRA FTTRKQCFST DVAAFSKTDY PLSHHAKMFE LHAAIAIPVQ  420
STYAGPVDFV LEFFFPKDCC NTEEQKRMWD ILPITIKQAC WSLHVVMDKE LEETVNKKMK  480
FASLFKESSE AESSWIARVA EAQQKGKGVC VSWDHRKEEN KEEFKVTSHW GKTQDELYHK  540
QAFPEFGKFQ QNSVPKGSIE STTDAASAEH HSVGSRKSGD KRRTKTEKTI SLQVLRQYFA  600
GSLKDAAKSI GVCPTTLKRI CRKHGITRWP SRKIKKVGHS LKKLQLVIDS VQGAEGAIQI  660
GSFYTTFPEL TSPNFSANGG FPSSKANDDS NKSNHRPENG IFSAAASASK SPSSSSSQSS  720
GSSICFSGYP LLVEDPGGVL KRTHSDAALH ALNRDKSEPL IRSQSFKTFG DLPNPETLPP  780
LPKSSSQIIR DRSGFRVKAT FGADKIRFTL QPNWGFRDLQ QEIARRFNID DICRIDLKYL  840
DDDQEWVLLT CDADLEECKD VYKLSESHTI KMSLNQPSQP HLGSSLGSVG PNLVSLLGGG  900
GPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313580.20.0RWP-RK domain-containing family protein
SwissprotQ8H1110.0NLP1_ARATH; Protein NLP1
TrEMBLB9HPY00.0B9HPY0_POPTR; RWP-RK domain-containing family protein
STRINGPOPTR_0009s16830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein